CAT# | R1110 |
M.F/Formula | C308H466N90O95S8 |
M.W/Mr. | 7206.1 |
Sequence | GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR(Modifications: Disulfide bridge: 13-64, 17-37, 23-47, 27-49, Arg-65 = C-terminal amide) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...