CAT# | R1110 |
M.F/Formula | C308H466N90O95S8 |
M.W/Mr. | 7206.1 |
Sequence | GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR(Modifications: Disulfide bridge: 13-64, 17-37, 23-47, 27-49, Arg-65 = C-terminal amide) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...