Neuropeptide Y(29-64)
Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.
Online Inquiry
| CAT# | R1548 |
| Chemical Structure |  |
| CAS | 303052-45-1 |
| M.F/Formula | C189H284N54O58S |
| M.W/Mr. | 4272.70 |
| Sequence | One Letter Code: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Three Letter Code: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr |
| Storage | Desiccate at -20°C |
Solubility | Water |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for Neuropeptide Y(29-64)
Required fields are marked with *
×
Ask a Question for Neuropeptide Y(29-64)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
