CAT# | AF3073 |
Sequence | DKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...