CAT# | AF3063 |
Sequence | DKLIGSCVWGAVNYTRNCNAECKRRGYKGGHCGSFANVNCWCET |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...