CAT# | AF3071 |
Sequence | DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNINCWCET |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...