CAT# | AF2592 |
Sequence | GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...