CAT# | AF3036 |
Sequence | TKYYGNGVYCNSKKCWVDWGQASGCIGQTVVGGWLGGAIPGKC |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...