CAT# | AF2390 |
Sequence | SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...
Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...