CAT# | AF3062 |
Sequence | DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCEE |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...