CRF(human,rat)
Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.
Online Inquiry
| CAT# | 10-101-294 |
| CAS | 86784-80-7 |
| Synonyms/Alias | Corticotropin-releasing factor (human); Human CRF; Human corticotropin-releasing factor |
| M.F/Formula | C208H344N60O63S2 |
| M.W/Mr. | 4758 |
| Sequence | One Letter Code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (Modifications: Ile-41 = C-terminal amide)
Three Letter Code: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 |
| Purity | > 98% |
| Storage | Desiccate at -20°C |
Solubility | Soluble to 1.10 mg/ml in water |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
InChI Key | VXFVFWFSJFSXHN-FAUHKOHMSA-N |
Write a review
Ask a question
My Review for CRF(human,rat)
Required fields are marked with *
×
Ask a Question for CRF(human,rat)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
