CAT# | AF2715 |
Sequence | GRKSDCFRKSGFCAFLKPSLTLISGKCSRFYLCCKRIW |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...
What is palmitoyl hexapeptide-12? Lipopeptides, also known as acylpeptides, consist of a hydrophilic peptide bond and a lipo ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
What is GIP? GIP (Gastric Inhibitory Polypeptide or Glucose-dependent Insulinotropic Peptide) is a peptide hormone composed ...