Calcitonin eel
Calcitonin eel is a peptide hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates.
Online Inquiry
| CAT# | 10-101-218 |
| Chemical Structure |  |
| CAS | 57014-02-5 |
| Synonyms/Alias | Eel calcitonin; Calcitonin (eel); Calcitonin, Eel; Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7], Thyrocalcitonin Eel |
| M.F/Formula | C146H241N43O47S2 |
| M.W/Mr. | 3414.87 |
| Sequence | One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP |
| Storage | Desiccate at -20°C |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for Calcitonin eel
Required fields are marked with *
×
Ask a Question for Calcitonin eel
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
