CAT# | AF2991 |
Sequence | DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...