CAT# | AF2661 |
Sequence | NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCRT |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...