CAT# | AF3147 |
Sequence | GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...