CAT# | AF2623 |
Sequence | GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...