CAT# | AF2680 |
Sequence | STPVLASVAVSMELLPTASVLYSDVAGCFKYSAKHHC |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...