CAT# | AF3037 |
Sequence | TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...
Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...