CAT# | AF2630 |
Sequence | GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...