CAT# | M16002 |
Sequence | PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...