CAT# | AF3283 |
Sequence | QKLCERPSGTWSGVCGNNGACRNQCIRLERARHGSCNYVFPAHKCICYFPC |
Activity | Fungi, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...