CAT# | AF2401 |
Sequence | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...