CAT# | C29016 |
M.F/Formula | C209H337N61O64S2 |
M.W/Mr. | 4792.6 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMENF-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...